Web Analysis for Tuguico - tuguico.com
1.67
Rating by CuteStat
tuguico.com is 8 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, tuguico.com is SAFE to browse.
PageSpeed Score
90
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | 4 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 3 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.185.108.139)
Trick Photography Ideas
- trickphotographyideas.net
how to do trick photography and special effects review
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectsreview.net
how to do trick photography and special effects
Not Applicable
$
8.95
Trick Photography
- trickphotographyspecialeffects.org
trick photography techniques how to shoot trick photos
Not Applicable
$
8.95
Trick Photography And Special Effects 2nd Edition Pdf
- trickphotographyandspecialeffectspdf.net
how to do trick photography and special effects
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx/1.8.1
Date: Wed, 27 Jan 2016 17:54:50 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://tuguico.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Server: nginx/1.8.1
Date: Wed, 27 Jan 2016 17:54:50 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://tuguico.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
tuguico.com | A | 14399 |
IP: 192.185.108.139 |
tuguico.com | NS | 21599 |
Target: loca244235.mars.orderbox-dns.com |
tuguico.com | NS | 21599 |
Target: loca244235.venus.orderbox-dns.com |
tuguico.com | NS | 21599 |
Target: loca244235.mercury.orderbox-dns.com |
tuguico.com | NS | 21599 |
Target: loca244235.earth.orderbox-dns.com |
tuguico.com | SOA | 7199 |
MNAME: loca244235.mercury.orderbox-dns.com RNAME: danilocha1.gmail.com Serial: 2016012503 Refresh: 7200 Retry: 7200 Expire: 172800 Minimum TTL: 38400 |
Full WHOIS Lookup
Whois Server Version 2.0
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: TUGUICO.COM
Registrar: CCI REG S.A.
Sponsoring Registrar IANA ID: 1607
Whois Server: whois.ccireg.com
Referral URL: http://www.ccireg.com
Name Server: LOCA244235.MERCURY.ORDERBOX-DNS.COM
Name Server: LOCA244235.VENUS.ORDERBOX-DNS.COM
Name Server: NS0.COM.CO
Name Server: NS9.COM.CO
Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Updated Date: 25-jan-2016
Creation Date: 25-jan-2016
Expiration Date: 25-jan-2017
>>> Last update of whois database: Wed, 27 Jan 2016 17:54:45 GMT
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: TUGUICO.COM
Registrar: CCI REG S.A.
Sponsoring Registrar IANA ID: 1607
Whois Server: whois.ccireg.com
Referral URL: http://www.ccireg.com
Name Server: LOCA244235.MERCURY.ORDERBOX-DNS.COM
Name Server: LOCA244235.VENUS.ORDERBOX-DNS.COM
Name Server: NS0.COM.CO
Name Server: NS9.COM.CO
Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Updated Date: 25-jan-2016
Creation Date: 25-jan-2016
Expiration Date: 25-jan-2017
>>> Last update of whois database: Wed, 27 Jan 2016 17:54:45 GMT