1.67 Rating by CuteStat

tuguico.com is 8 years 4 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, tuguico.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.185.108.139

Hosted Country:

United States of America US

Location Latitude:

29.8284

Location Longitude:

-95.4696
Tuguico – Otro sitio realizado con WordPress

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.185.108.139)

Trick Photography Ideas

- trickphotographyideas.net

how to do trick photography and special effects review

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectsreview.net

how to do trick photography and special effects

Not Applicable $ 8.95

Trick Photography

- trickphotographyspecialeffects.org

trick photography techniques how to shoot trick photos

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectspdf.net

how to do trick photography and special effects

Not Applicable $ 8.95

Fundación Instituto Hipólito Unanue

- fihu-diagnostico.org.pe
1,357,204 $ 480.00

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.8.1
Date: Wed, 27 Jan 2016 17:54:50 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Link: <http://tuguico.com/wp-json/>; rel="https://api.w.org/"
Content-Encoding: gzip

Domain Information

Domain Registrar: CCI REG S.A.
Registration Date: Jan 25, 2016, 12:00 AM 8 years 4 months 3 weeks ago
Last Modified: Jan 25, 2016, 12:00 AM 8 years 4 months 3 weeks ago
Expiration Date: Jan 25, 2017, 12:00 AM 7 years 4 months 2 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
loca244235.mercury.orderbox-dns.com 162.251.82.250 United States of America United States of America
loca244235.venus.orderbox-dns.com 162.251.82.248 United States of America United States of America
ns0.com.co 192.185.108.133 United States of America United States of America
ns9.com.co 192.185.108.134 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
tuguico.com A 14399 IP: 192.185.108.139
tuguico.com NS 21599 Target: loca244235.mars.orderbox-dns.com
tuguico.com NS 21599 Target: loca244235.venus.orderbox-dns.com
tuguico.com NS 21599 Target: loca244235.mercury.orderbox-dns.com
tuguico.com NS 21599 Target: loca244235.earth.orderbox-dns.com
tuguico.com SOA 7199 MNAME: loca244235.mercury.orderbox-dns.com
RNAME: danilocha1.gmail.com
Serial: 2016012503
Refresh: 7200
Retry: 7200
Expire: 172800
Minimum TTL: 38400

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: TUGUICO.COM
Registrar: CCI REG S.A.
Sponsoring Registrar IANA ID: 1607
Whois Server: whois.ccireg.com
Referral URL: http://www.ccireg.com
Name Server: LOCA244235.MERCURY.ORDERBOX-DNS.COM
Name Server: LOCA244235.VENUS.ORDERBOX-DNS.COM
Name Server: NS0.COM.CO
Name Server: NS9.COM.CO
Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Updated Date: 25-jan-2016
Creation Date: 25-jan-2016
Expiration Date: 25-jan-2017

>>> Last update of whois database: Wed, 27 Jan 2016 17:54:45 GMT